EVX2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EVX2 antibody: synthetic peptide directed towards the N terminal of human LOC344191. Synthetic peptide located within the following region: GELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYSEAAAEA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	even-skipped homeobox 2
Database Link	NP_001073927 Entrez Gene 344191 Human UniProt ID Q03828
Background	LOC344191 is a new candidate transcription factor.
Synonyms	EVX-2
Note	Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.