Gjc3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Gje1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GFRLLILVSSGPGVFGNDENEFICHLGQPGCKTICYDVFRPLSPLRFWAF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	gap junction protein, gamma 3
Database Link	NP_536698 Entrez Gene 118446 Mouse UniProt ID Q921C1
Background	One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Synonyms	Connexin-30.2; Connexin-31.3; Cx29; CX30.2; Cx31.3; GJE1
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.