LYL1 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LYL1 antibody: synthetic peptide directed towards the C terminal of human LYL1. Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | lymphoblastic leukemia associated hematopoiesis regulator 1 |
Database Link | |
Background | LYL1 contains 1 basic helix-loop-helix (bHLH) domain. A chromosomal aberration, translocation t (7;19)(q35;p13) with TCRB, involving LYL1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). |
Synonyms | bHLHa18 |
Note | Immunogen sequence homology: Human: 100%; Pig: 92% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |