GCP2 (CXCL6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CXCL6 antibody: synthetic peptide directed towards the middle region of human CXCL6. Synthetic peptide located within the following region: GKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	12 kDa
Gene Name	C-X-C motif chemokine ligand 6
Database Link	NP_002984 Entrez Gene 6372 Human UniProt ID P80162
Background	CXCL6 is chemotactic for neutrophil granulocytes.
Synonyms	CKA-3; GCP-2; GCP2; SCYB6
Note	Immunogen sequence homology: Human: 100%; Rat: 86%; Horse: 86%; Pig: 85%; Rabbit: 85%; Guinea pig: 85%; Bovine: 82%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Chemokine signaling pathway, Cytokine-cytokine receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.