LYL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LYL1 antibody is: synthetic peptide directed towards the C-terminal region of Human LYL1. Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	lymphoblastic leukemia associated hematopoiesis regulator 1
Database Link	NP_005574 Entrez Gene 4066 Human UniProt ID P12980
Background	This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia.
Synonyms	bHLHa18
Note	Immunogen sequence homology: Pig: 100%; Human: 100%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.