Reep2 Mouse Monoclonal Antibody [Clone ID: N326D/13]

Specifications

Product Data
Clone Name	N326D/13
Applications	IF, IHC, WB
Recommend Dilution	Immunoblot (IB) Immunohistochemistry (IHC) Immunocytochemistry (ICC)
Reactivity	Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 111-254 (cytoplasmic C-terminus) of mouse REEP2 (also known as Receptor expression-enhancing protein 2, C5orf19, SGC32445 and LOC682105, accession number Q8VCD6). Rat: 97% identity (140/144 amino acids identical) Human: 86% identity (125/144 amino acids identical) <40% identity with REEP1 and REEP4 but >65% identity for first 46 amino acids (RDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDL)
Specificity	Cross-reacts with REEP1. Cross-reacts with other unidentified proteins.
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	receptor accessory protein 2
Database Link	Entrez Gene 225362 Mouse UniProt ID Q8VCD6
Synonyms	C5orf19; SGC32445
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.