Egln2 (NM_053208) Mouse Recombinant Protein

CAT#: TP506645

Purified recombinant protein of Mouse egl-9 family hypoxia-inducible factor 2 (Egln2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206645 protein sequence
Red=Cloning site Green=Tags(s)

MDSPCQPQALNQALPQLPGSVSESLESSRARMGVESYLPCPLLPAYHRPGASGEASAGNGTPRTTATATT
TTASPLREGFGGQDGGELWPLQSEGAAALVTKECQRLAAQGARPEAPKRKWAKDGGDAPSPSKRPWARQE
NQEAKGESGMGCDSGASNSSSSSSNTTSSSGEASARLREEVQPSAPERLALDYIVPCMRYYGICVKDNFL
GAVLGGRVLAEVEALKWGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCA
GRLGNYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVA
NIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAARDKYQLASGQKGVQVPVSQPTTPT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_444438
Locus ID 112406
UniProt ID Q91YE2, Q80X29
Refseq Size 2124
Cytogenetics 7 15.83 cM
Refseq ORF 1260
Synonyms 0610011A13Rik; C85656; Hif-p4h-1; Ier4; Phd1; SM-20
Summary Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN2 is involved in regulating hypoxia tolerance and apoptosis in cardiac and skeletal muscle. Also regulates susceptibility to normoxic oxidative neuronal death. Links oxygen sensing to cell cycle and primary cilia formation by hydroxylating the critical centrosome component CEP192 which promotes its ubiquitination and subsequent proteasomal degradation. Hydroxylates IKBKB, mediating NF-kappaB activation in hypoxic conditions. Target proteins are preferentially recognized via a LXXLAP motif.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...