Tmem97 (NM_133706) Mouse Recombinant Protein

CAT#: TP501535

Purified recombinant protein of Mouse transmembrane protein 97 (Tmem97), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201535 protein sequence
Red=Cloning site Green=Tags(s)

MGALAARRCVEWLLGLYFVSHIPITLFIDLQAVLPPELYPQEFSNLLRWYSKEFKDPLMQEPPVWFKSFL
LCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAAHTITTLIPILYTLLFEDFSKAVAFKGQRPESFRER
LTLVGVYAPYLIIPLILLLFMLRNPYYKYEEKRKKK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 20.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598467
Locus ID 69071
UniProt ID Q8VD00
Refseq Size 1333
Cytogenetics 11 46.74 cM
Refseq ORF 531
Synonyms 1810014L12Rik; AI115531; AL022956; D11Bhm182e
Summary Intracellular orphan receptor that binds numerous drugs and which is highly expressed in various proliferating cells. Corresponds to the sigma-2 receptor, which is thought to play important role in regulating cell survival, morphology and differentiation. May play a role as a regulator of cellular cholesterol homeostasis. May function as sterol isomerase. May alter the activity of some cytochrome P450 proteins.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...