HEPACAM (NM_152722) Human Recombinant Protein
CAT#: TP323693
Recombinant protein of human hepatocyte cell adhesion molecule (HEPACAM), 20 µg
View other "HEPACAM" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223693 representing NM_152722
Red=Cloning site Green=Tags(s) MKRERGALSRASRALRLAPFVYLLLIQTDPLEGVNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQ LKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLT VDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLME DDDLYSCVVENPISQGRSLPVKITVYRRSSLYIILSTGGIFLLVTLVTVCACWKPSKRKQKKLEKQNSLE YMDQNDDRLKPEADTLPRSGEQERKNPMALYILKDKDSPETEENPAPEPRSATEPGPPGYSVSPAVPGRS PGLPIRSARRYPRSPARSPATGRTHSSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEISA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689935 |
Locus ID | 220296 |
UniProt ID | Q14CZ8 |
Refseq Size | 3258 |
Cytogenetics | 11q24.2 |
Refseq ORF | 1248 |
Synonyms | GlialCAM; HEPN1; MLC2A; MLC2B |
Summary | The protein encoded by this gene is a single-pass type I membrane protein that localizes to the cytoplasmic side of the cell membrane. The encoded protein acts as a homodimer and is involved in cell motility and cell-matrix interactions. The expression of this gene is downregulated or undetectable in many cancer cell lines, so this may be a tumor suppressor gene. [provided by RefSeq, Jul 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407342 | HEPACAM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY407342 | Transient overexpression lysate of hepatocyte cell adhesion molecule (HEPACAM) |
CNY 4,840.00 |
|
PH323693 | HEPACAM MS Standard C13 and N15-labeled recombinant protein (NP_689935) |
CNY 14,250.00 |
其它HEPACAM产品