ZBTB8OS (NM_178547) Human Recombinant Protein
CAT#: TP321460L
Purified recombinant protein of Homo sapiens zinc finger and BTB domain containing 8 opposite strand (ZBTB8OS), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221460 representing NM_178547
Red=Cloning site Green=Tags(s) MKGGSRVSNPAVMAQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAM AMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPREVKVLSIDQRNFKLRSIGW GEEFSLSKHPQGTEVKAITYSAMQVYNEENPEVFVIIDI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848642 |
Locus ID | 339487 |
UniProt ID | Q8IWT0, A8K0B5 |
Refseq Size | 717 |
Cytogenetics | 1p35.1 |
Refseq ORF | 537 |
Synonyms | ARCH; ARCH2 |
Summary | Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB. Together with DDX1, acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它ZBTB8OS产品