RAB27A (NM_183235) Human Recombinant Protein
CAT#: TP319810
Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 3, 20 µg
View other "RAB27A" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219810 representing NM_183235
Red=Cloning site Green=Tags(s) MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL SEEKEKGACGC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_899058 |
Locus ID | 5873 |
UniProt ID | P51159, A2RU94 |
Refseq Size | 3464 |
Cytogenetics | 15q21.3 |
Refseq ORF | 663 |
Synonyms | GS2; HsT18676; RAB27; RAM |
Summary | The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405229 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405230 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405231 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417890 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430653 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405229 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 2 |
CNY 3,080.00 |
|
LY405230 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 3 |
CNY 3,080.00 |
|
LY405231 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 4 |
CNY 3,080.00 |
|
LY417890 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 1 |
CNY 3,080.00 |
|
PH317900 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899057) |
CNY 19,520.00 |
|
PH319810 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899058) |
CNY 14,250.00 |
|
PH320897 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_004571) |
CNY 14,250.00 |
|
PH323511 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899059) |
CNY 14,250.00 |
|
TP317900 | Recombinant protein of human RAB27A, member RAS oncogene family (RAB27A), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP320897 | Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP323511 | Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 4, 20 µg |
CNY 2,900.00 |