NMDAR1 (GRIN1) (NM_007327) Human Recombinant Protein
CAT#: TP316458
Recombinant protein of human glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-3, 20 µg
View other "NMDAR1" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
热销蛋白,享双倍赠礼
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216458 representing NM_007327
Red=Cloning site Green=Tags(s) MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPN AIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRT VPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERESKAEKVLQFDPGTKNVTALLME AKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAH ISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFAN YSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERV NNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQS TLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSAR ILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELS TMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQ NVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQ NQKDTVLPRRAIEREEGQLQLCSRHRES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 103.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_015566 |
Locus ID | 2902 |
UniProt ID | Q05586 |
Refseq Size | 5137 |
Cytogenetics | 9q34.3 |
Refseq ORF | 2814 |
Synonyms | GluN1; MRD8; NDHMSD; NDHMSR; NMD-R1; NMDA1; NMDAR1; NR1 |
Summary | The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Glutamate Receptors, Transmembrane |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Calcium signaling pathway, Huntington's disease, Long-term potentiation, Neuroactive ligand-receptor interaction |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Study of B Cell Repertoire in Patients With Anti-N-Methyl-D-Aspartate Receptor Encephalitis
,null,
Frontiers in Immunology
,PubMed ID 32849520
[GRIN1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402129 | GRIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424497 | GRIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402129 | Transient overexpression lysate of glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-3 |
CNY 4,840.00 |
|
LY424497 | Transient overexpression lysate of glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-1 |
CNY 4,840.00 |
|
PH316458 | GRIN1 MS Standard C13 and N15-labeled recombinant protein (NP_015566) |
CNY 19,520.00 |
|
PH319368 | GRIN1 MS Standard C13 and N15-labeled recombinant protein (NP_000823) |
CNY 19,520.00 |
|
TP319368 | Recombinant protein of human glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-1, 20 µg |
CNY 2,900.00 |
|
TP790146 | Purified recombinant protein of Human glutamate receptor, ionotropic, N-methyl D-aspartate 1 (GRIN1), transcript variant NR1-3, with C-terminal DDK tag, secretory expressed in CHO cells, 50ug |
CNY 3,900.00 |