United States
Germany
Japan
United Kingdom
China
SIRP alpha (SIRPA) (NM_001040023) Human Recombinant Protein
CAT＃: TP316320
Recombinant protein of human signal-regulatory protein alpha (SIRPA), transcript variant 2, 20 µg
View other "SIRP alpha" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>Peptide sequence encoded by RC216320
Blue=ORF Red=Cloning site Green=Tag(s) MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWF RGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSY SIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSH DLKVSAHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPK QPAPKPEPSFSEYASVQVPRK myc-FLAG tag Recombinant protein using RC216320 also available, TP316320 |
| Tag | C-Myc/DDK |
| Predicted MW | 52.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035112 |
| Locus ID | 140885 |
| UniProt ID | P78324 |
| Refseq Size | 4580 |
| Cytogenetics | 20p13 |
| Refseq ORF | 1509 |
| Synonyms | BIT; CD172A; MFR; MYD-1; P84; PTPNS1; SHPS1; SIRP |
| Summary | The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein can be phosphorylated by tyrosine kinases. The phospho-tyrosine residues of this PTP have been shown to recruit SH2 domain containing tyrosine phosphatases (PTP), and serve as substrates of PTPs. This protein was found to participate in signal transduction mediated by various growth factor receptors. CD47 has been demonstrated to be a ligand for this receptor protein. This gene and its product share very high similarity with several other members of the SIRP family. These related genes are located in close proximity to each other on chromosome 20p13. Multiple alternatively spliced transcript variants have been determined for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409074 | SIRPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421878 | SIRPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC421879 | SIRPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY409074 | Transient overexpression lysate of signal-regulatory protein alpha (SIRPA), transcript variant 3 |
CNY 3,080.00 |
|
| LY421878 | Transient overexpression lysate of signal-regulatory protein alpha (SIRPA), transcript variant 1 |
CNY 4,840.00 |
|
| LY421879 | Transient overexpression lysate of signal-regulatory protein alpha (SIRPA), transcript variant 2 |
CNY 4,840.00 |
|
| PH307315 | SIRPA MS Standard C13 and N15-labeled recombinant protein (NP_542970) |
CNY 19,520.00 |
|
| PH316320 | SIRPA MS Standard C13 and N15-labeled recombinant protein (NP_001035112) |
CNY 19,520.00 |
|
| PH322380 | SIRPA MS Standard C13 and N15-labeled recombinant protein (NP_001035111) |
CNY 19,520.00 |
|
| TP307315 | Recombinant protein of human signal-regulatory protein alpha (SIRPA), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP322380 | Recombinant protein of human signal-regulatory protein alpha (SIRPA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP723932 | Human SIRP alpha Protein, hFc-His Tag |
CNY 5,876.00 |
|
| TP762372 | Purified recombinant protein of Human signal-regulatory protein alpha (SIRPA), transcript variant 1, Glu31-Ile373, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它SIRP alpha产品
