STEAP3 (NM_001008410) Human Recombinant Protein
CAT#: TP310595
Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 3, 20 µg
View other "STEAP3" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210595 protein sequence
Red=Cloning site Green=Tags(s) MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008410 |
Locus ID | 55240 |
UniProt ID | Q658P3, A1P3F0 |
Refseq Size | 3870 |
Cytogenetics | 2q14.2 |
Refseq ORF | 1464 |
Synonyms | AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6 |
Summary | This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Protein Families | Transmembrane |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405328 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC413214 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423432 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425238 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405328 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 1 |
CNY 4,840.00 |
|
LY413214 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 2 |
CNY 3,080.00 |
|
LY423432 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 3 |
CNY 3,080.00 |
|
PH310595 | STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_001008410) |
CNY 19,520.00 |
|
PH324274 | STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_060704) |
CNY 19,520.00 |
|
TP324274 | Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 2, 20 µg |
CNY 2,900.00 |