GPNMB (NM_001005340) Human Recombinant Protein
CAT#: TP307615
Recombinant protein of human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1, 20 µg
View other "GPNMB" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207615 representing NM_001005340
Red=Cloning site Green=Tags(s) MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWK NSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSE DSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEV TVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTIN YKWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNT PGPAGDNPLELSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTSTLISVPDRDP ASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEKD PLLKNQEFKGVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Pull-down assay (PMID: 26751287) |
Reference Data | |
RefSeq | NP_001005340 |
Locus ID | 10457 |
UniProt ID | Q14956 |
Refseq Size | 2775 |
Cytogenetics | 7p15.3 |
Refseq ORF | 1716 |
Synonyms | HGFIN; NMB; PLCA3 |
Summary | The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The LINK-A lncRNA activates normoxic HIF1 [alpha] signalling in triple-negative breast cancer
,Lin, A;Li, C;Xing, Z;Hu, Q;Liang, K;Han, L;Wang, C;,
Nature cell biology
,PubMed ID 26751287
[GPNMB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400379 | GPNMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400379 | Transient overexpression lysate of glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1 |
CNY 3,080.00 |
|
PH307615 | GPNMB MS Standard C13 and N15-labeled recombinant protein (NP_001005340) |
CNY 19,520.00 |
|
TP720414 | Recombinant protein of human glycoprotein (transmembrane) nmb (GPNMB), transcript variant 1 |
CNY 4,060.00 |