SENP8 (NM_145204) Human Recombinant Protein
CAT#: TP306791
Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), 20 µg
View other "SENP8" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206791 protein sequence
Red=Cloning site Green=Tags(s) MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAE IAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFL GRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLA KK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660205 |
Locus ID | 123228 |
UniProt ID | Q96LD8, A8K8D3 |
Refseq Size | 1569 |
Cytogenetics | 15q23 |
Refseq ORF | 636 |
Synonyms | DEN1; NEDP1; PRSC2 |
Summary | This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407943 | SENP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432692 | SENP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407943 | Transient overexpression lysate of SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 2 |
CNY 3,080.00 |
|
LY432692 | Transient overexpression lysate of SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1 |
CNY 3,080.00 |
|
PH306791 | SENP8 MS Standard C13 and N15-labeled recombinant protein (NP_660205) |
CNY 19,520.00 |
|
TP329692 | Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720150 | Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1. |
CNY 3,710.00 |