Calreticulin 3 (CALR3) (NM_145046) Human Recombinant Protein
CAT#: TP305398
Recombinant protein of human calreticulin 3 (CALR3), 20 µg
View other "Calreticulin 3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205398 protein sequence
Red=Cloning site Green=Tags(s) MARALVQFWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQ NGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFD IKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETS PAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKM KNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKE EMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659483 |
Locus ID | 125972 |
UniProt ID | Q96L12, A0A140VJF7 |
Refseq Size | 1295 |
Cytogenetics | 19p13.11 |
Refseq ORF | 1152 |
Synonyms | CMH19; CRT2; CT93 |
Summary | The protein encoded by this gene belongs to the calreticulin family, members of which are calcium-binding chaperones localized mainly in the endoplasmic reticulum. This protein is also localized to the endoplasmic reticulum lumen, however, its capacity for calcium-binding may be absent or much lower than other family members. This gene is specifically expressed in the testis, and may be required for sperm fertility. Mutation in this gene has been associated with familial hypertrophic cardiomyopathy. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403418 | CALR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403418 | Transient overexpression lysate of calreticulin 3 (CALR3) |
CNY 3,080.00 |
|
PH305398 | CALR3 MS Standard C13 and N15-labeled recombinant protein (NP_659483) |
CNY 19,520.00 |
|
TP721001 | Purified recombinant protein of Human calreticulin 3 (CALR3) |
CNY 4,360.00 |
其它Calreticulin 3产品