C3AR1 (NM_004054) Human Recombinant Protein
CAT#: TP304730
Recombinant protein of human complement component 3a receptor 1 (C3AR1), 20 µg
View other "C3AR1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204730 protein sequence
Red=Cloning site Green=Tags(s) MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLL CCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMAC SICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDR LDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHET SPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSV IMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVC IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004045 |
Locus ID | 719 |
UniProt ID | Q16581, A8K2H7 |
Refseq Size | 1985 |
Cytogenetics | 12p13.31 |
Refseq ORF | 1446 |
Synonyms | AZ3B; C3AR; HNFAG09 |
Summary | C3a is an anaphylatoxin released during activation of the complement system. The protein encoded by this gene is an orphan G protein-coupled receptor for C3a. Binding of C3a by the encoded receptor activates chemotaxis, granule enzyme release, superoxide anion production, and bacterial opsonization. [provided by RefSeq, May 2016] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Complement and coagulation cascades, Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401314 | C3AR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401314 | Transient overexpression lysate of complement component 3a receptor 1 (C3AR1) |
CNY 3,080.00 |
|
PH304730 | C3AR1 MS Standard C13 and N15-labeled recombinant protein (NP_004045) |
CNY 19,520.00 |