FABP3 (NM_004102) Human Recombinant Protein
CAT#: TP302737
Recombinant protein of human fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3), 20 µg
View other "FABP3" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 3,600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202737 protein sequence
Red=Cloning site Green=Tags(s) MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVE FDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004093 |
Locus ID | 2170 |
UniProt ID | P05413, A0A384MDY5 |
Refseq Size | 1097 |
Cytogenetics | 1p35.2 |
Refseq ORF | 399 |
Synonyms | FABP11; H-FABP; M-FABP; MDGI; O-FABP |
Summary | The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418213 | FABP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418213 | Transient overexpression lysate of fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3) |
CNY 3,080.00 |
|
PH302737 | FABP3 MS Standard C13 and N15-labeled recombinant protein (NP_004093) |
CNY 19,520.00 |
|
TP720116 | Recombinant protein of human fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3) |
CNY 4,550.00 |
|
TP750160 | Purified recombinant protein of Human leptin (LEP),Val22-end, tag free, expressed in E. coli, 50ug |
CNY 1,948.00 |
|
TP790065 | Purified recombinant protein of Human fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) (FABP3), with N-terminal HIS tag, expressed in HEK293, 50ug |
CNY 3,900.00 |