PMM1 (NM_002676) Human Recombinant Protein
CAT#: TP302004
Recombinant protein of human phosphomannomutase 1 (PMM1), 20 µg
View other "PMM1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202004 protein sequence
Red=Cloning site Green=Tags(s) MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVI EKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISP IGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSF DTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002667 |
Locus ID | 5372 |
UniProt ID | Q92871, A0A024R1U5 |
Refseq Size | 1295 |
Cytogenetics | 22q13.2 |
Refseq ORF | 786 |
Synonyms | PMM 1; PMMH-22; Sec53 |
Summary | Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylation and thus the secretion of several glycoproteins as well as for the synthesis of glycosyl-phosphatidyl-inositol (GPI) anchored proteins. [provided by RefSeq, Jul 2008] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419180 | PMM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419180 | Transient overexpression lysate of phosphomannomutase 1 (PMM1) |
CNY 3,080.00 |
|
PH302004 | PMM1 MS Standard C13 and N15-labeled recombinant protein (NP_002667) |
CNY 19,520.00 |
|
TP720222 | Recombinant protein of human phosphomannomutase 1 (PMM1) |
CNY 5,460.00 |