Apolipoprotein O (APOO) (NM_024122) Human Recombinant Protein
CAT#: TP301451
Recombinant protein of human apolipoprotein O (APOO), transcript variant 1, 20 µg
View other "Apolipoprotein O" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201451 protein sequence
Red=Cloning site Green=Tags(s) MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077027 |
Locus ID | 79135 |
UniProt ID | Q9BUR5 |
Refseq Size | 1134 |
Cytogenetics | Xp22.11 |
Refseq ORF | 594 |
Synonyms | FAM121B; Mic23; MIC26; MICOS26; My025 |
Summary | This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.[provided by RefSeq, Sep 2009] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411353 | APOO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411353 | Transient overexpression lysate of apolipoprotein O (APOO), transcript variant 1 |
CNY 3,080.00 |
|
PH301451 | APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027) |
CNY 19,520.00 |
其它Apolipoprotein O产品