United States
Germany
Japan
United Kingdom
China
Caspase-7 (CASP7) (NM_033338) Human Mass Spec Standard
CAT＃: PH321589
CASP7 MS Standard C13 and N15-labeled recombinant protein (NP_203124)
View other "Caspase-7" proteins (17)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | CASP7 MS Standard C13 and N15-labeled recombinant protein (NP_203124) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221589 |
| Predicted MW | 37.6 kDa |
| Protein Sequence |
>RC221589 representing NM_033338
Red=Cloning site Green=Tags(s) MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQMADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFS KKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFD VIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEK PKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCS ILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_203124 |
| RefSeq Size | 2712 |
| RefSeq ORF | 1008 |
| Synonyms | CASP-7; CMH-1; ICE-LAP3; LICE2; MCH3 |
| Locus ID | 840 |
| Cytogenetics | 10q25.3 |
| Summary | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The precursor of the encoded protein is cleaved by caspase 3 and 10, is activated upon cell death stimuli and induces apoptosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Alzheimer's disease, Apoptosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409591 | CASP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409592 | CASP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409593 | CASP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420060 | CASP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429055 | CASP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429870 | CASP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409591 | Transient overexpression lysate of caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant delta |
CNY 3,080.00 |
|
| LY409592 | Transient overexpression lysate of caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant gamma |
CNY 3,080.00 |
|
| LY409593 | Transient overexpression lysate of caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant beta |
CNY 3,080.00 |
|
| LY420060 | Transient overexpression lysate of caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant alpha |
CNY 3,080.00 |
|
| LY429055 | Transient overexpression lysate of caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant alpha |
CNY 3,080.00 |
|
| LY429870 | Transient overexpression lysate of caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant delta |
CNY 3,080.00 |
|
| PH302059 | CASP7 MS Standard C13 and N15-labeled recombinant protein (NP_203125) |
CNY 19,520.00 |
|
| PH321545 | CASP7 MS Standard C13 and N15-labeled recombinant protein (NP_001218) |
CNY 19,520.00 |
|
| TP302059 | Recombinant protein of human caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant gamma, 20 µg |
CNY 2,900.00 |
|
| TP321545 | Recombinant protein of human caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant alpha, 20 µg |
CNY 2,900.00 |
|
| TP321589 | Purified recombinant protein of Homo sapiens caspase 7, apoptosis-related cysteine peptidase (CASP7), transcript variant delta, 20 µg |
CNY 2,900.00 |
其它Caspase-7产品
