FAM3C (NM_001040020) Human Mass Spec Standard
CAT#: PH318912
FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_001035109)
View other "FAM3C" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_001035109) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218912 |
Predicted MW | 24.7 kDa |
Protein Sequence |
>RC218912 protein sequence
Red=Cloning site Green=Tags(s) MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFA FKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQ DGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYE GWPEVVEMEGCIPQKQD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001035109 |
RefSeq Size | 2512 |
RefSeq ORF | 681 |
Synonyms | GS3786; ILEI |
Locus ID | 10447 |
Cytogenetics | 7q31.31 |
Summary | This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414959 | FAM3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421876 | FAM3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414959 | Transient overexpression lysate of family with sequence similarity 3, member C (FAM3C), transcript variant 1 |
CNY 3,080.00 |
|
LY421876 | Transient overexpression lysate of family with sequence similarity 3, member C (FAM3C), transcript variant 2 |
CNY 3,080.00 |
|
PH301036 | FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_055703) |
CNY 19,520.00 |
|
TP301036 | Recombinant protein of human family with sequence similarity 3, member C (FAM3C), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP318912 | Recombinant protein of human family with sequence similarity 3, member C (FAM3C), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720641 | Purified recombinant protein of Human family with sequence similarity 3, member C (FAM3C), transcript variant 1 |
CNY 4,550.00 |