STAT1 (NM_007315) Human Mass Spec Standard
CAT#: PH313858
STAT1 MS Standard C13 and N15-labeled recombinant protein (NP_009330)
View other "STAT1" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 4,840.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | STAT1 MS Standard C13 and N15-labeled recombinant protein (NP_009330) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213858 |
Predicted MW | 87.2 kDa |
Protein Sequence |
>RC213858 representing NM_007315
Red=Cloning site Green=Tags(s) MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSR FSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQK ELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKR KEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKL EELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVK LQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTP PCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIES ILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHA VEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTG YIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009330 |
RefSeq Size | 4157 |
RefSeq ORF | 2250 |
Synonyms | CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91 |
Locus ID | 6772 |
Cytogenetics | 2q32.2 |
Summary | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. The protein encoded by this gene can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. The protein plays an important role in immune responses to viral, fungal and mycobacterial pathogens. Mutations in this gene are associated with Immunodeficiency 31B, 31A, and 31C. [provided by RefSeq, Jun 2020] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Chemokine signaling pathway, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408329 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416045 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429341 | STAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY408329 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta |
CNY 3,080.00 |
|
LY416045 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha |
CNY 4,840.00 |
|
LY429341 | Transient overexpression lysate of signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha |
CNY 4,840.00 |
|
PH301075 | STAT1 MS Standard C13 and N15-labeled recombinant protein (NP_644671) |
CNY 19,520.00 |
|
TP301075 | Recombinant protein of human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta, 20 µg |
CNY 2,900.00 |
|
TP313858 | Recombinant protein of human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant alpha, 20 µg |
CNY 2,900.00 |
|
TP720884 | Purified recombinant protein of Human signal transducer and activator of transcription 1, 91kDa (STAT1), transcript variant beta |
CNY 4,550.00 |