Alkaline Phosphatase (ALPP) (NM_001632) Human Mass Spec Standard
CAT#: PH310504
ALPP MS Standard C13 and N15-labeled recombinant protein (NP_001623)
View other "Alkaline Phosphatase" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ALPP MS Standard C13 and N15-labeled recombinant protein (NP_001623) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210504 |
Predicted MW | 58 kDa |
Protein Sequence |
>RC210504 protein sequence
Red=Cloning site Green=Tags(s) MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVST VTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARF NQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIAT QLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASL DPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRAL TETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACL EPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001623 |
RefSeq Size | 2883 |
RefSeq ORF | 1605 |
Synonyms | ALP; ALPI; IAP; PALP; PLAP; PLAP-1 |
Locus ID | 250 |
Cytogenetics | 2q37.1 |
Summary | The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells. [provided by RefSeq, Aug 2020] |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419831 | ALPP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419831 | Transient overexpression lysate of alkaline phosphatase, placental (Regan isozyme) (ALPP) |
CNY 3,080.00 |
|
TP310504 | Recombinant protein of human alkaline phosphatase, placental (Regan isozyme) (ALPP), 20 µg |
CNY 2,900.00 |
|
TP721056 | Purified recombinant protein of Human alkaline phosphatase, placental (ALPP) |
CNY 5,460.00 |
其它Alkaline Phosphatase产品