Y14 (RBM8A) (NM_005105) Human Mass Spec Standard
CAT#: PH309770
RBM8A MS Standard C13 and N15-labeled recombinant protein (NP_005096)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RBM8A MS Standard C13 and N15-labeled recombinant protein (NP_005096) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209770 |
Predicted MW | 19.7 kDa |
Protein Sequence |
>RC209770 representing NM_005105
Red=Cloning site Green=Tags(s) MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV EGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005096 |
RefSeq Size | 2787 |
RefSeq ORF | 522 |
Synonyms | BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1 |
Locus ID | 9939 |
Cytogenetics | 1q21.1 |
Summary | This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417520 | RBM8A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417520 | Transient overexpression lysate of RNA binding motif protein 8A (RBM8A) |
CNY 3,080.00 |
|
TP309770 | Recombinant protein of human RNA binding motif protein 8A (RBM8A), 20 µg |
CNY 2,900.00 |