CEACAM1 (NM_001024912) Human Mass Spec Standard
CAT#: PH304901
CEACAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001020083)
View other "CEACAM1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CEACAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001020083) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204901 |
Predicted MW | 51.1 kDa |
Protein Sequence |
>RC204901 protein sequence
Red=Cloning site Green=Tags(s) MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKG ERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHV YPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDT GPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQS TQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCST NDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALP QENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRTTPMTHLTR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001020083 |
RefSeq Size | 3475 |
RefSeq ORF | 1404 |
Synonyms | BGP; BGP1; BGPI |
Locus ID | 634 |
Cytogenetics | 19q13.2 |
Summary | This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of all variants has not been defined. [provided by RefSeq, May 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC433069 | CEACAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433126 | CEACAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY433069 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) (CEACAM1), transcript variant 4 |
CNY 3,080.00 |
|
LY433126 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) (CEACAM1), transcript variant 3 |
CNY 3,080.00 |
|
TP304901 | Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) (CEACAM1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP330069 | Purified recombinant protein of Homo sapiens carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) (CEACAM1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP330126 | Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) (CEACAM1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720375 | Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) (CEACAM1), transcript variant 2 |
CNY 4,060.00 |
其它CEACAM1产品