SULT2B1 (NM_177973) Human Mass Spec Standard
CAT#: PH304478
SULT2B1 MS Standard C13 and N15-labeled recombinant protein (NP_814444)
View other "SULT2B1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SULT2B1 MS Standard C13 and N15-labeled recombinant protein (NP_814444) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204478 |
Predicted MW | 41.3 kDa |
Protein Sequence |
>RC204478 protein sequence
Red=Cloning site Green=Tags(s) MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK SGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKA KVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITY EELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGD WKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS PSPGQASETPHPRPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_814444 |
RefSeq Size | 1228 |
RefSeq ORF | 1095 |
Synonyms | ARCI14; HSST2 |
Locus ID | 6820 |
Cytogenetics | 19q13.33 |
Summary | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Pathways | Androgen and estrogen metabolism, Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406066 | SULT2B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406066 | Transient overexpression lysate of sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2 |
CNY 3,080.00 |
|
TP304478 | Recombinant protein of human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP710313 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720859 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2 |
CNY 4,360.00 |
其它SULT2B1产品