ICAD (DFFA) (NM_004401) Human Mass Spec Standard
CAT#: PH302879
DFFA MS Standard C13 and N15-labeled recombinant protein (NP_004392)
View other "ICAD" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | DFFA MS Standard C13 and N15-labeled recombinant protein (NP_004392) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202879 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC202879 protein sequence
Red=Cloning site Green=Tags(s) MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIV DDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIIL LSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQE ESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIK KTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004392 |
RefSeq Size | 2053 |
RefSeq ORF | 993 |
Synonyms | DFF-45; DFF1; ICAD |
Locus ID | 1676 |
Cytogenetics | 1p36.22 |
Summary | Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Apoptosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418008 | DFFA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418008 | Transient overexpression lysate of DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 |
CNY 3,080.00 |
|
TP302879 | Recombinant protein of human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720857 | Purified recombinant protein of Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 |
CNY 4,360.00 |