LIMPII (SCARB2) (NM_005506) Human Mass Spec Standard
CAT#: PH302162
SCARB2 MS Standard C13 and N15-labeled recombinant protein (NP_005497)
View other "LIMPII" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SCARB2 MS Standard C13 and N15-labeled recombinant protein (NP_005497) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202162 |
Predicted MW | 54.3 kDa |
Protein Sequence |
>RC202162 protein sequence
Red=Cloning site Green=Tags(s) MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVT NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPV LTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGYKDEILSLIHVFRPDISPYFGLFYEKNGTND GDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYIT FSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFV SAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKE TASRLKSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPLIRT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005497 |
RefSeq Size | 4780 |
RefSeq ORF | 1434 |
Synonyms | AMRF; CD36L2; EPM4; HLGP85; LGP85; LIMP-2; LIMPII; SR-BII |
Locus ID | 950 |
Cytogenetics | 4q21.1 |
Summary | The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Earlier studies in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. The protein deficiency in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. Further studies in human showed that this protein is a ubiquitously expressed protein and that it is involved in the pathogenesis of HFMD (hand, foot, and mouth disease) caused by enterovirus-71 and possibly by coxsackievirus A16. Mutations in this gene caused an autosomal recessive progressive myoclonic epilepsy-4 (EPM4), also known as action myoclonus-renal failure syndrome (AMRF). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401685 | SCARB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401685 | Transient overexpression lysate of scavenger receptor class B, member 2 (SCARB2) |
CNY 3,080.00 |
|
TP302162 | Recombinant protein of human scavenger receptor class B, member 2 (SCARB2), 20 µg |
CNY 2,900.00 |
|
TP720440 | Recombinant protein of human scavenger receptor class B, member 2 (SCARB2) |
CNY 5,020.00 |