United States
Germany
Japan
United Kingdom
China
PDHA1 (NM_000284) Human Mass Spec Standard
CAT＃: PH301831
PDHA1 MS Standard C13 and N15-labeled recombinant protein (NP_000275)
View other "PDHA1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | PDHA1 MS Standard C13 and N15-labeled recombinant protein (NP_000275) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201831 |
| Predicted MW | 43.3 kDa |
| Protein Sequence |
>RC201831 protein sequence
Red=Cloning site Green=Tags(s) MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQT VRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTG RKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNM AALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPI LMELQTYRYHGHSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAA QFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKSVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000275 |
| RefSeq Size | 3390 |
| RefSeq ORF | 1170 |
| Synonyms | PDHA; PDHAD; PDHCE1A; PHE1A |
| Locus ID | 5160 |
| Cytogenetics | Xp22.12 |
| Summary | The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle. The PDH complex is composed of multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3). The E1 enzyme is a heterotetramer of two alpha and two beta subunits. This gene encodes the E1 alpha 1 subunit containing the E1 active site, and plays a key role in the function of the PDH complex. Mutations in this gene are associated with pyruvate dehydrogenase E1-alpha deficiency and X-linked Leigh syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism, Valine, leucine and isoleucine biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400110 | PDHA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432934 | PDHA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432995 | PDHA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433066 | PDHA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400110 | Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 1 (PDHA1), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
| LY432934 | Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 1 (PDHA1), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3,080.00 |
|
| LY432995 | Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 1 (PDHA1), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
| LY433066 | Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 1 (PDHA1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
| TP301831 | Recombinant protein of human pyruvate dehydrogenase (lipoamide) alpha 1 (PDHA1), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
