DNA polymerase delta p50 (POLD2) (NM_006230) Human Mass Spec Standard
CAT#: PH301793
POLD2 MS Standard C13 and N15-labeled recombinant protein (NP_006221)
View other "DNA polymerase delta p50" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | POLD2 MS Standard C13 and N15-labeled recombinant protein (NP_006221) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201793 |
Predicted MW | 51.3 kDa |
Protein Sequence |
>RC201793 protein sequence
Red=Cloning site Green=Tags(s) MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQ QHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQ RIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGE SLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLD EILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPED QTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006221 |
RefSeq Size | 1648 |
RefSeq ORF | 1407 |
Locus ID | 5425 |
Cytogenetics | 7p13 |
Summary | This gene encodes the 50-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein is required for the stimulation of DNA polymerase delta activity by the processivity cofactor proliferating cell nuclear antigen (PCNA). Expression of this gene may be a marker for ovarian carcinomas. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Mar 2012] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Base excision repair, DNA replication, Homologous recombination, Metabolic pathways, Mismatch repair, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416786 | POLD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426719 | POLD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416786 | Transient overexpression lysate of polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2 |
CNY 3,080.00 |
|
LY426719 | Transient overexpression lysate of polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1 |
CNY 3,080.00 |
|
PH325794 | POLD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120690) |
CNY 19,520.00 |
|
TP301793 | Recombinant protein of human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325794 | Recombinant protein of human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720925 | Purified recombinant protein of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2 |
CNY 5,460.00 |
其它DNA polymerase delta p50产品