NCBP2 (NM_007362) Human Mass Spec Standard
CAT#: PH301519
NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_031388)
View other "NCBP2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_031388) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201519 |
Predicted MW | 18 kDa |
Protein Sequence |
>RC201519 protein sequence
Red=Cloning site Green=Tags(s) MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKII MGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQ DYDAGRGGYGKLAQNQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_031388 |
RefSeq Size | 2175 |
RefSeq ORF | 468 |
Synonyms | CBC2; CBP20; NIP1; PIG55 |
Locus ID | 22916 |
Cytogenetics | 3q29 |
Summary | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402134 | NCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402134 | Transient overexpression lysate of nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 1 |
CNY 3,080.00 |
|
PH321605 | NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001036005) |
CNY 14,250.00 |
|
TP301519 | Recombinant protein of human nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP321605 | Purified recombinant protein of Homo sapiens nuclear cap binding protein subunit 2, 20kDa (NCBP2), transcript variant 2, 20 µg |
CNY 2,900.00 |