HMGB2 (NM_002129) Human Mass Spec Standard
CAT#: PH300750
HMGB2 MS Standard C13 and N15-labeled recombinant protein (NP_002120)
View other "HMGB2" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HMGB2 MS Standard C13 and N15-labeled recombinant protein (NP_002120) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200750 |
Predicted MW | 24 kDa |
Protein Sequence |
>RC200750 protein sequence
Red=Cloning site Green=Tags(s) MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002120 |
RefSeq Size | 1527 |
RefSeq ORF | 627 |
Synonyms | HMG2 |
Locus ID | 3148 |
Cytogenetics | 4q34.1 |
Summary | This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419515 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427242 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427243 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419515 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 1 |
CNY 3,080.00 |
|
LY427242 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 2 |
CNY 3,080.00 |
|
LY427243 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 3 |
CNY 3,080.00 |
|
TP300750 | Recombinant protein of human high-mobility group box 2 (HMGB2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720732 | Purified recombinant protein of Human high mobility group box 2 (HMGB2), transcript variant 1 |
CNY 5,460.00 |
|
TP760625 | Purified recombinant protein of Human high mobility group box 2 (HMGB2), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |