United States
Germany
Japan
United Kingdom
China
UL131A (NC_006273) Virus Tagged ORF Clone
CAT＃: VC101298
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL131A [Human herpesvirus 5], codon optimized for human cell expression, YP_081566
View other clones from "Virus" (142)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>The Viral ORF clone VC101298 represents NCBI reference of YP_081566 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGGCTGTGCCGGGTGTGGCTGAGCGTGTGCCTGTGCGCCGTCGTGCTCGGACAATGCCAGCGGGAGA CCGCCGAGAAGAACGACTACTACCGGGTGCCACACTACTGGGACGCCTGCAGCCGGGCCCTGCCCGACCA GACCCGGTACAAGTACGTGGAGCAGCTGGTGGACCTCACCCTGAACTACCACTACGACGCCAGCCACGGC CTGGACAACTTCGACGTGCTGAAACGGATCAACGTGACCGAGGTGAGCCTGCTGATCAGCGACTTCCGGC GGCAGAACCGGCGGGGCGGCACCAACAAGCGGACCACCTTCAACGCCGCCGGCAGCCTGGCCCCCCACGC CCGGAGCCTGGAGTTCAGCGTGAGACTCTTTGCTAAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101298 representing YP_081566
Red=Cloning sites Green=Tags MRLCRVWLSVCLCAVVLGQCQRETAEKNDYYRVPHYWDACSRALPDQTRYKYVEQLVDLTLNYHYDASHG LDNFDVLKRINVTEVSLLISDFRRQNRRGGTNKRTTFNAAGSLAPHARSLEFSVRLFAN TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_006273 |
| ORF Size | 387 bp |
| OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Reference Data | |
| RefSeq | NC_006273.2, YP_081566 |
| RefSeq ORF | 387 bp |
| Locus ID | 3077493 |
| MW | 15.0 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC101187 | Myc-DDK-tagged ORF clone of viral ORF for protein RL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081455 |
CNY 3,800.00 |
|
| VC101188 | Myc-DDK-tagged ORF clone of viral ORF for protein RL5A [Human herpesvirus 5], codon optimized for human cell expression, YP_081456 |
CNY 3,800.00 |
|
| VC101189 | Myc-DDK-tagged ORF clone of viral ORF for protein RL6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081457 |
CNY 3,800.00 |
|
| VC101190 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein RL10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081458 |
CNY 3,800.00 |
|
| VC101191 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein RL11 [Human herpesvirus 5], codon optimized for human cell expression, YP_081459 |
CNY 3,800.00 |
|
| VC101192 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein RL12 [Human herpesvirus 5], codon optimized for human cell expression, YP_081460 |
CNY 5,130.00 |
|
| VC101193 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein RL13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081461 |
CNY 3,800.00 |
|
| VC101194 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081462 |
CNY 3,800.00 |
|
| VC101195 | Myc-DDK-tagged ORF clone of viral ORF for protein UL2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081463 |
CNY 3,800.00 |
|
| VC101196 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL4 [Human herpesvirus 5], codon optimized for human cell expression, YP_081464 |
CNY 3,800.00 |
|
| VC101197 | Myc-DDK-tagged ORF clone of viral ORF for protein UL5 [Human herpesvirus 5], codon optimized for human cell expression, YP_081465 |
CNY 3,800.00 |
|
| VC101198 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081466 |
CNY 3,800.00 |
|
| VC101199 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081467 |
CNY 3,800.00 |
|
| VC101200 | Myc-DDK-tagged ORF clone of viral ORF for protein UL8 [Human herpesvirus 5], codon optimized for human cell expression, YP_081468 |
CNY 3,800.00 |
|
| VC101201 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL9 [Human herpesvirus 5], codon optimized for human cell expression, YP_081469 |
CNY 3,800.00 |
|
| VC101202 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081470 |
CNY 3,600.00 |
|
| VC101204 | Myc-DDK-tagged ORF clone of viral ORF for protein UL13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081472 |
CNY 5,800.00 |
|
| VC101205 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081473 |
CNY 3,800.00 |
|
| VC101206 | Myc-DDK-tagged ORF clone of viral ORF for protein UL15A [Human herpesvirus 5], codon optimized for human cell expression, YP_081474 |
CNY 3,800.00 |
|
| VC101207 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081475 |
CNY 3,600.00 |
|
| VC101208 | Myc-DDK-tagged ORF clone of viral ORF for protein UL17 [Human herpesvirus 5], codon optimized for human cell expression, YP_081476 |
CNY 3,800.00 |
|
| VC101209 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL18 [Human herpesvirus 5], codon optimized for human cell expression, YP_081477 |
CNY 4,024.00 |
|
| VC101210 | Myc-DDK-tagged ORF clone of viral ORF for protein UL19 [Human herpesvirus 5], codon optimized for human cell expression, YP_081478 |
CNY 3,800.00 |
|
| VC101211 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL20 [Human herpesvirus 5], codon optimized for human cell expression, YP_081479 |
CNY 4,090.00 |
|
| VC101212 | Myc-DDK-tagged ORF clone of viral ORF for protein UL21A [Human herpesvirus 5], codon optimized for human cell expression, YP_081480 |
CNY 3,800.00 |
|
| VC101213 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein UL22A [Human herpesvirus 5], codon optimized for human cell expression, YP_081481 |
CNY 3,800.00 |
|
| VC101214 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 5], codon optimized for human cell expression, YP_081482 |
CNY 3,800.00 |
|
| VC101215 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 5], codon optimized for human cell expression, YP_081483 |
CNY 3,800.00 |
|
| VC101216 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL25 [Human herpesvirus 5], codon optimized for human cell expression, YP_081484 |
CNY 7,890.00 |
|
| VC101217 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL26 [Human herpesvirus 5], codon optimized for human cell expression, YP_081485 |
CNY 3,800.00 |
|
| VC101218 | Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 5], codon optimized for human cell expression, YP_081486 |
CNY 7,320.00 |
|
| VC101219 | Myc-DDK-tagged ORF clone of viral ORF for protein UL29 [Human herpesvirus 5], codon optimized for human cell expression, YP_081487 |
CNY 10,550.00 |
|
| VC101220 | Myc-DDK-tagged ORF clone of viral ORF for protein UL30 [Human herpesvirus 5], codon optimized for human cell expression, YP_081489 |
CNY 3,800.00 |
|
| VC101221 | Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 5], codon optimized for human cell expression, YP_081490 |
CNY 7,130.00 |
|
| VC101222 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 5], codon optimized for human cell expression, YP_081491 |
CNY 15,870.00 |
|
| VC101223 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 5], codon optimized for human cell expression, YP_081492 |
CNY 4,940.00 |
|
| VC101224 | Myc-DDK-tagged ORF clone of viral ORF for protein UL34 [Human herpesvirus 5], codon optimized for human cell expression, YP_081493 |
CNY 4,940.00 |
|
| VC101225 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 5], codon optimized for human cell expression, YP_081494 |
CNY 7,700.00 |
|
| VC101226 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 5], codon optimized for human cell expression, YP_081495 |
CNY 5,800.00 |
|
| VC101227 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 5], codon optimized for human cell expression, YP_081496 |
CNY 5,990.00 |
|
| VC101228 | Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 5], codon optimized for human cell expression, YP_081497 |
CNY 3,800.00 |
|
| VC101229 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL40 [Human herpesvirus 5], codon optimized for human cell expression, YP_081498 |
CNY 2,640.00 |
|
| VC101230 | Myc-DDK-tagged ORF clone of viral ORF for protein UL41A [Human herpesvirus 5], codon optimized for human cell expression, YP_081499 |
CNY 3,800.00 |
|
| VC101231 | Myc-DDK-tagged ORF clone of viral ORF for protein UL42 [Human herpesvirus 5], codon optimized for human cell expression, YP_081500 |
CNY 3,800.00 |
|
| VC101232 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 5], codon optimized for human cell expression, YP_081501 |
CNY 5,230.00 |
|
| VC101233 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081502 |
CNY 5,320.00 |
|
| VC101234 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081503 |
CNY 13,680.00 |
|
| VC101235 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081504 |
CNY 3,800.00 |
|
| VC101236 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 5], codon optimized for human cell expression, YP_081505 |
CNY 14,820.00 |
|
| VC101238 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081507 |
CNY 3,800.00 |
|
| VC101239 | Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 5], codon optimized for human cell expression, YP_081508 |
CNY 6,840.00 |
|
| VC101240 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081509 |
CNY 4,750.00 |
|
| VC101241 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 5], codon optimized for human cell expression, YP_081510 |
CNY 3,800.00 |
|
| VC101242 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 5], codon optimized for human cell expression, YP_081511 |
CNY 10,070.00 |
|
| VC101243 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081512 |
CNY 4,470.00 |
|
| VC101244 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081513 |
CNY 18,810.00 |
|
| VC101245 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 5], codon optimized for human cell expression, YP_081514 |
CNY 13,680.00 |
|
| VC101246 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081515 |
CNY 12,920.00 |
|
| VC101248 | Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 5], codon optimized for human cell expression, YP_081517 |
CNY 11,120.00 |
|
| VC101249 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081518 |
CNY 14,250.00 |
|
| VC101250 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 5], codon optimized for human cell expression, YP_081519 |
CNY 4,280.00 |
|
| VC101251 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 5], codon optimized for human cell expression, YP_081520 |
CNY 4,660.00 |
|
| VC101252 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 5], codon optimized for human cell expression, YP_081521 |
CNY 3,800.00 |
|
| VC101253 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 5], codon optimized for human cell expression, YP_081522 |
CNY 5,800.00 |
|
| VC101254 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24, partial [Human herpesvirus 5], codon optimized for human cell expression, YP_002802310 |
CNY 3,800.00 |
|
| VC101255 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 5], codon optimized for human cell expression, YP_081523 |
CNY 11,120.00 |
|
| VC101258 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 5], codon optimized for human cell expression, YP_081526 |
CNY 5,320.00 |
|
| VC101259 | Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 5], codon optimized for human cell expression, YP_081527 |
CNY 3,800.00 |
|
| VC101262 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp71 [Human herpesvirus 5], codon optimized for human cell expression, YP_081530 |
CNY 4,160.00 |
|
| VC101263 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 5], codon optimized for human cell expression, YP_081531 |
CNY 4,176.00 |
|
| VC101264 | Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 5], codon optimized for human cell expression, YP_081532 |
CNY 7,030.00 |
|
| VC101265 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081533 |
CNY 3,800.00 |
|
| VC101267 | Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 5], codon optimized for human cell expression, YP_081535 |
CNY 14,160.00 |
|
| VC101268 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 5], codon optimized for human cell expression, YP_081536 |
CNY 5,230.00 |
|
| VC101269 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081537 |
CNY 10,170.00 |
|
| VC101270 | Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 5], codon optimized for human cell expression, YP_081538 |
CNY 3,800.00 |
|
| VC101271 | Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 5], codon optimized for human cell expression, YP_081539 |
CNY 3,800.00 |
|
| VC101273 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081541 |
CNY 4,090.00 |
|
| VC101275 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081543 |
CNY 3,800.00 |
|
| VC101276 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 5], codon optimized for human cell expression, YP_081544 |
CNY 10,640.00 |
|
| VC101277 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 5], codon optimized for human cell expression, YP_081545 |
CNY 7,030.00 |
|
| VC101278 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081546 |
CNY 3,800.00 |
|
| VC101279 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 5], codon optimized for human cell expression, YP_081547 |
CNY 4,470.00 |
|
| VC101281 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081549 |
CNY 3,800.00 |
|
| VC101282 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081550 |
CNY 10,550.00 |
|
| VC101284 | Myc-DDK-tagged ORF clone of viral ORF for interleukin-10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081552 |
CNY 3,800.00 |
|
| VC101286 | Myc-DDK-tagged ORF clone of viral ORF for large tegument protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081554 |
CNY 3,800.00 |
|
| VC101287 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 5], codon optimized for human cell expression, YP_081555 |
CNY 3,800.00 |
|
| VC101291 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL120 [Human herpesvirus 5], codon optimized for human cell expression, YP_081559 |
CNY 3,800.00 |
|
| VC101292 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL121 [Human herpesvirus 5], codon optimized for human cell expression, YP_081560 |
CNY 3,800.00 |
|
| VC101293 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081561 |
CNY 6,480.00 |
|
| VC101294 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081562 |
CNY 4,024.00 |
|
| VC101295 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 5], codon optimized for human cell expression, YP_081563 |
CNY 3,800.00 |
|
| VC101296 | Myc-DDK-tagged ORF clone of viral ORF for truncated envelope protein UL128 [Human herpesvirus 5], codon optimized for human cell expression, YP_081564 |
CNY 3,800.00 |
|
| VC101297 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL130 [Human herpesvirus 5], codon optimized for human cell expression, YP_081565 |
CNY 3,800.00 |
|
| VC101299 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL132 [Human herpesvirus 5], codon optimized for human cell expression, YP_081567 |
CNY 3,800.00 |
|
| VC101300 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL148 [Human herpesvirus 5], codon optimized for human cell expression, YP_081568 |
CNY 3,800.00 |
|
| VC101301 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL147A [Human herpesvirus 5], codon optimized for human cell expression, YP_081569 |
CNY 3,800.00 |
|
| VC101302 | Myc-DDK-tagged ORF clone of viral ORF for chemokine vCXCL2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081570 |
CNY 3,800.00 |
|
| VC101303 | Myc-DDK-tagged ORF clone of viral ORF for chemokine vCXCL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081571 |
CNY 3,800.00 |
|
| VC101304 | Myc-DDK-tagged ORF clone of viral ORF for protein UL145 [Human herpesvirus 5], codon optimized for human cell expression, YP_081572 |
CNY 3,800.00 |
|
| VC101305 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL144 [Human herpesvirus 5], codon optimized for human cell expression, YP_081573 |
CNY 3,600.00 |
|
| VC101306 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL142 [Human herpesvirus 5], codon optimized for human cell expression, YP_081574 |
CNY 3,600.00 |
|
| VC101307 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL141 [Human herpesvirus 5], codon optimized for human cell expression, YP_081575 |
CNY 3,656.00 |
|
| VC101308 | Myc-DDK-tagged ORF clone of viral ORF for protein UL140 [Human herpesvirus 5], codon optimized for human cell expression, YP_081576 |
CNY 3,800.00 |
|
| VC101309 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL139 [Human herpesvirus 5], codon optimized for human cell expression, YP_081577 |
CNY 3,800.00 |
|
| VC101310 | Myc-DDK-tagged ORF clone of viral ORF for protein UL138 [Human herpesvirus 5], codon optimized for human cell expression, YP_081578 |
CNY 3,600.00 |
|
| VC101312 | Myc-DDK-tagged ORF clone of viral ORF for protein UL135 [Human herpesvirus 5], codon optimized for human cell expression, YP_081580 |
CNY 3,800.00 |
|
| VC101314 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148A [Human herpesvirus 5], codon optimized for human cell expression, YP_081582 |
CNY 3,800.00 |
|
| VC101315 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148B [Human herpesvirus 5], codon optimized for human cell expression, YP_081583 |
CNY 3,800.00 |
|
| VC101316 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148C [Human herpesvirus 5], codon optimized for human cell expression, YP_081584 |
CNY 3,800.00 |
|
| VC101317 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148D [Human herpesvirus 5], codon optimized for human cell expression, YP_081585 |
CNY 3,800.00 |
|
| VC101318 | Myc-DDK-tagged ORF clone of viral ORF for protein UL150 [Human herpesvirus 5], codon optimized for human cell expression, YP_081586 |
CNY 7,700.00 |
|
| VC101321 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081589 |
CNY 2,640.00 |
|
| VC101322 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US3 [Human herpesvirus 5], codon optimized for human cell expression, YP_081590 |
CNY 3,800.00 |
|
| VC101323 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081591 |
CNY 3,800.00 |
|
| VC101324 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081592 |
CNY 3,800.00 |
|
| VC101325 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US8 [Human herpesvirus 5], codon optimized for human cell expression, YP_081593 |
CNY 3,800.00 |
|
| VC101326 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US9 [Human herpesvirus 5], codon optimized for human cell expression, YP_081594 |
CNY 3,800.00 |
|
| VC101327 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081595 |
CNY 3,800.00 |
|
| VC101328 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US11 [Human herpesvirus 5], codon optimized for human cell expression, YP_081596 |
CNY 2,400.00 |
|
| VC101329 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US12 [Human herpesvirus 5], codon optimized for human cell expression, YP_081597 |
CNY 3,800.00 |
|
| VC101330 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081598 |
CNY 3,800.00 |
|
| VC101331 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081599 |
CNY 3,800.00 |
|
| VC101332 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US15 [Human herpesvirus 5], codon optimized for human cell expression, YP_081600 |
CNY 3,800.00 |
|
| VC101333 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081601 |
CNY 3,800.00 |
|
| VC101334 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US17 [Human herpesvirus 5], codon optimized for human cell expression, YP_081602 |
CNY 3,800.00 |
|
| VC101335 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US18 [Human herpesvirus 5], codon optimized for human cell expression, YP_081603 |
CNY 3,800.00 |
|
| VC101336 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US19 [Human herpesvirus 5], codon optimized for human cell expression, YP_081604 |
CNY 3,800.00 |
|
| VC101337 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US20 [Human herpesvirus 5], codon optimized for human cell expression, YP_081605 |
CNY 3,800.00 |
|
| VC101338 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US21 [Human herpesvirus 5], codon optimized for human cell expression, YP_081606 |
CNY 3,800.00 |
|
| VC101339 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein US22 [Human herpesvirus 5], codon optimized for human cell expression, YP_081607 |
CNY 6,940.00 |
|
| VC101340 | Myc-DDK-tagged ORF clone of viral ORF for protein US23 [Human herpesvirus 5], codon optimized for human cell expression, YP_081608 |
CNY 7,130.00 |
|
| VC101342 | Myc-DDK-tagged ORF clone of viral ORF for protein US26 [Human herpesvirus 5], codon optimized for human cell expression, YP_081610 |
CNY 7,220.00 |
|
| VC101343 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein US27 [Human herpesvirus 5], codon optimized for human cell expression, YP_081611 |
CNY 5,488.00 |
|
| VC101344 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein US28 [Human herpesvirus 5], codon optimized for human cell expression, YP_081612 |
CNY 3,656.00 |
|
| VC101345 | Myc-DDK-tagged ORF clone of viral ORF for protein US29 [Human herpesvirus 5], codon optimized for human cell expression, YP_081613 |
CNY 5,610.00 |
|
| VC101346 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US30 [Human herpesvirus 5], codon optimized for human cell expression, YP_081614 |
CNY 4,180.00 |
|
| VC101347 | Myc-DDK-tagged ORF clone of viral ORF for protein US31 [Human herpesvirus 5], codon optimized for human cell expression, YP_081615 |
CNY 3,800.00 |
|
| VC101348 | Myc-DDK-tagged ORF clone of viral ORF for protein US32 [Human herpesvirus 5], codon optimized for human cell expression, YP_081616 |
CNY 3,800.00 |
|
| VC101349 | Myc-DDK-tagged ORF clone of viral ORF for protein US34 [Human herpesvirus 5], codon optimized for human cell expression, YP_081617 |
CNY 3,800.00 |
|
| VC101350 | Myc-DDK-tagged ORF clone of viral ORF for protein US34A [Human herpesvirus 5], codon optimized for human cell expression, YP_081618 |
CNY 3,800.00 |
