ATF2 (NM_001256094) Human Tagged ORF Clone

CAT#: RG232140

  • TrueORF®

ATF2 (tGFP-tagged) - Homo sapiens activating transcription factor 2 (ATF2), transcript variant 6

ORF Plasmid: DDK tGFP



  "NM_001256094" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


ATF2 Rabbit Polyclonal Antibody
    • 100 ul

CNY 2,700.00

热销推荐

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms CRE-BP1; CREB-2; CREB2; HB16; TREB7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG232140 representing NM_001256094
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAATTCAAGTTACATGTGAATTCTGCCAGGCAATACAAGGACCTGTGGAATATGAGTGATGACAAAC
CCTTTCTATGTACTGCGCCTGGATGTGGCCAGCGTTTTACCAACGAGGATCATTTGGCTGTCCATAAACA
TAAACATGAGATGACACTGAAATTTGGTCCAGCACGTAATGACAGTGTCATTGTGGCTGATCAGACCCCA
ACACCAACAAGATTCTTGAAAAACTGTGAAGAAGTGGGTTTGTTTAATGAGTTGGCGAGTCCATTTGAGA
ATGAATTCAAGAAAGCTTCAGAAGATGACATTAAAAAAATGCCTCTAGATTTATCCCCTCTTGCAACACC
TATCATAAGAAGCAAAATTGAGGAGCCTTCTGTTGTAGAAACAACTCACCAGGATAGTCCTTTACCTCAC
CCAGAGTCTACTACCAGTGATGAGAAGGAAGTACCATTGGCACAAACTGCACAGCCCACATCAGCTATTG
TTCGTCCAGCATCATTACAGGTTCCCAATGTGCTGCTTACAAGTTCTGACTCAAGTGTAATTATTCAGCA
GGCAGTACCTTCACCAACCTCAAGTACTGTAATCACCCAGGCACCATCCTCTAACAGGCCAATTGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG232140 representing NM_001256094
Red=Cloning site Green=Tags(s)

MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTP
TPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPH
PESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001256094
ORF Size 627 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001256094.1, NP_001243023.1
RefSeq Size 1372 bp
RefSeq ORF 630 bp
Locus ID 1386
UniProt ID P15336
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway
Gene Summary This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. It forms a homodimer or a heterodimer with c-Jun and stimulates CRE-dependent transcription. This protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components. The encoded protein may also be involved in cell's DNA damage response independent of its role in transcriptional regulation. Several alternatively spliced transcript variants have been found for this gene [provided by RefSeq, Jan 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...