CD63 (NM_001780) Human Tagged ORF Clone
CAT#: RG201733
- TrueORF®
CD63 (tGFP-tagged) - Human CD63 molecule (CD63), transcript variant 1
ORF Plasmid: DDK
"NM_001780" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 4,000.00
CNY 4,370.00
Cited in 6 publications. |
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | LAMP-3; ME491; MLA1; OMA81H; TSPAN30 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG201733 representing NM_001780
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGTGGAAGGAGGAATGAAATGTGTGAAGTTCTTGCTCTACGTCCTCCTGCTGGCCTTTTGCGCCT GTGCAGTGGGACTGATTGCCGTGGGTGTCGGGGCACAGCTTGTCCTGAGTCAGACCATAATCCAGGGGGC TACCCCTGGCTCTCTGTTGCCAGTGGTCATCATCGCAGTGGGTGTCTTCCTCTTCCTGGTGGCTTTTGTG GGCTGCTGCGGGGCCTGCAAGGAGAACTATTGTCTTATGATCACGTTTGCCATCTTTCTGTCTCTTATCA TGTTGGTGGAGGTGGCCGCAGCCATTGCTGGCTATGTGTTTAGAGATAAGGTGATGTCAGAGTTTAATAA CAACTTCCGGCAGCAGATGGAGAATTACCCGAAAAACAACCACACTGCTTCGATCCTGGACAGGATGCAG GCAGATTTTAAGTGCTGTGGGGCTGCTAACTACACAGATTGGGAGAAAATCCCTTCCATGTCGAAGAACC GAGTCCCCGACTCCTGCTGCATTAATGTTACTGTGGGCTGTGGGATTAATTTCAACGAGAAGGCGATCCA TAAGGAGGGCTGTGTGGAGAAGATTGGGGGCTGGCTGAGGAAAAATGTGCTGGTGGTAGCTGCAGCAGCC CTTGGAATTGCTTTTGTCGAGGTTTTGGGAATTGTCTTTGCCTGCTGCCTCGTGAAGAGTATCAGAAGTG GCTACGAGGTGATG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG201733 representing NM_001780
Red=Cloning site Green=Tags(s) MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA LGIAFVEVLGIVFACCLVKSIRSGYEVM TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001780 |
ORF Size | 714 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001780.6 |
RefSeq Size | 1031 bp |
RefSeq ORF | 717 bp |
Locus ID | 967 |
UniProt ID | P08962 |
Domains | transmembrane4 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Lysosome |
Gene Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012] |
Citations (6)
The use of this cDNA Clones has been cited in the following citations: |
---|
Repurposing ketoconazole as an exosome directed adjunct to sunitinib in treating renal cell carcinoma
,Greenberg, JW;Kim, H;Moustafa, AA;Datta, A;Barata, PC;Boulares, AH;Abdel-Mageed, AB;Krane, LS;,
Scientific reports
,PubMed ID 33986386
[CD63]
|
Large-scale generation of functional mRNA-encapsulating exosomes via cellular nanoporation
,Yang, Z;Shi, J;Xie, J;Wang, Y;Sun, J;Liu, T;Zhao, Y;Zhao, X;Wang, X;Ma, Y;Malkoc, V;Chiang, C;Deng, W;Chen, Y;Fu, Y;Kwak, KJ;Fan, Y;Kang, C;Yin, C;Rhee, J;Bertani, P;Otero, J;Lu, W;Yun, K;Lee, AS;Jiang, W;Teng, L;Kim, BYS;Lee, LJ;,
Nat Biomed Eng
,PubMed ID 31844155
[CD63]
|
High-throughput screening identified selective inhibitors of exosome biogenesis and secretion: A drug repurposing strategy for advanced cancer
,Datta, A;Kim, H;McGee, L;Johnson, AE;Talwar, S;Marugan, J;Southall, N;Hu, X;Lal, M;Mondal, D;Ferrer, M;Abdel-Mageed, AB;,
Sci Rep
,PubMed ID 29802284
[CD63]
|
Expression of MicroRNA-34a in Alzheimer's Disease Brain Targets Genes Linked to Synaptic Plasticity, Energy Metabolism, and Resting State Network Activity
,Sarkar, S;Jun, S;Rellick, S;Quintana, DD;Cavendish, JZ;Simpkins, JW;,
Brain Res.
,PubMed ID 27235866
[CD63]
|
Inhibition of Oncogenic Epidermal Growth Factor Receptor Kinase Triggers Release of Exosome-like Extracellular Vesicles and Impacts Their Phosphoprotein and DNA Content
,Montermini, L;Meehan, B;Garnier, D;Lee, WJ;Lee, TH;Guha, A;Al-Nedawi, K;Rak, J;,
J. Biol. Chem.
,PubMed ID 26272609
[CD63]
|
Detachment of Breast Tumor Cells Induces Rapid Secretion of Exosomes Which Subsequently Mediate Cellular Adhesion and Spreading
,Rainelli B. Koumangoye, Amos M. Sakwe, J. Shawn Goodwin, Tina Patel, Josiah Ochieng,
PLoS One. 2011;6(9):e24234. doi: 10.1371/journal.pone.0024234. Epub 2011 Sep 6.
[CD63]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201733 | CD63 (Myc-DDK-tagged)-Human CD63 molecule (CD63), transcript variant 1 |
CNY 2,400.00 |
|
RC201733L1 | Lenti ORF clone of Human CD63 molecule (CD63), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC201733L2 | Lenti ORF clone of Human CD63 molecule (CD63), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC201733L3 | Lenti ORF clone of Human CD63 molecule (CD63), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC201733L4 | Lenti ORF clone of Human CD63 molecule (CD63), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
SC126650 | CD63 (untagged)-Human CD63 molecule (CD63), transcript variant 1 |
CNY 2,400.00 |
|
SC324357 | CD63 (untagged)-Human CD63 molecule (CD63), transcript variant 1 |
CNY 2,400.00 |