Lunatic Fringe (LFNG) (NM_002304) Human Tagged ORF Clone

CAT#: RC229769

  • TrueORF®

LFNG (Myc-DDK-tagged)-Human LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (LFNG), transcript variant 4

ORF Plasmid: DDK tGFP



  "NM_002304" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


LFNG rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms SCDO3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229769 representing NM_002304
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACACCAGGTCGCTGCTGTCTTGCGGCTGACATTCAGGTAGAGACGTTCATCTTCACTGACGGGGAAG
ATGAGGCCCTGGCCAGGCACACGGGCAACGTGGTCATCACAAACTGCTCGGCCGCCCACAGCCGCCAGGC
GCTGTCCTGCAAGATGGCCGTGGAGTATGACCGCTTCATCGAGTCCGGCAGGAAGTGGTTCTGCCACGTG
GACGATGACAACTACGTCAACCTGCGGGCCCTGCTGCGGCTGCTGGCCAGCTACCCGCACACGCGGGACG
TCTACGTCGGCAAGCCCAGCCTGGACAGGCCCATCCAGGCCATGGAGCGGGTCAGCGAGAACAAGGTGCG
TCCTGTCCACTTCTGGTTTGCCACGGGCGGCGCTGGCTTCTGCATCAGCCGTGGGCTGGCTCTGAAGATG
AGCCCGTGGGCCAGCGGGGGTCACTTCATGAATACGGCTGAGCGGATCCGGCTGCCTGATGACTGCACCA
TCGGCTACATCGTGGAGGCCCTGCTGGGTGTGCCCCTCATCCGCAGCGGCCTCTTCCACTCCCACCTGGA
GAACCTGCAGCAGGTGCCCACCTCGGAGCTCCACGAGCAGGTGACGCTGAGCTACGGTATGTTTGAAAAC
AAGCGGAACGCCGTCCACGTGAAGGGGCCCTTCTCGGTGGAGGCCGACCCATCCAGGTTCCGCTCCATCC
ACTGCCACCTGTACCCGGACACACCCTGGTGTCCCCGCACTGCCATCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229769 representing NM_002304
Red=Cloning site Green=Tags(s)

MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHV
DDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFATGGAGFCISRGLALKM
SPWASGGHFMNTAERIRLPDDCTIGYIVEALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFEN
KRNAVHVKGPFSVEADPSRFRSIHCHLYPDTPWCPRTAIF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002304
ORF Size 750 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002304.2, NP_002295.1
RefSeq ORF 753 bp
Locus ID 3955
UniProt ID Q8NES3
Protein Families Transmembrane
Protein Pathways Notch signaling pathway
MW 28.6 kDa
Gene Summary This gene is a member of the glycosyltransferase 31 gene family. Members of this gene family, which also includes the MFNG (GeneID: 4242) and RFNG (GeneID: 5986) genes, encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, these proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. The protein encoded by this gene is predicted to be a single-pass type II Golgi membrane protein but it may also be secreted and proteolytically processed like the related proteins in mouse and Drosophila (PMID: 9187150). Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. [provided by RefSeq, May 2018]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...