United States
Germany
Japan
United Kingdom
China
MGMT (NM_002412) Human Tagged ORF Clone
CAT＃: RC229131
MGMT (Myc-DDK-tagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT)
ORF Plasmid: tGFP
"NM_002412" in other vectors (12)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
| Cited in 5 publications. |
Product images
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC229131 representing NM_002412
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTGGGACAGCCCGCGCCCCTAGAACGCTTTGCGTCCCGACGCCCGCAGGTCCTCGCGGTGCGCACCG TTTGCGACTTGGTACTTGGAAAAATGGACAAGGATTGTGAAATGAAACGCACCACACTGGACAGCCCTTT GGGGAAGCTGGAGCTGTCTGGTTGTGAGCAGGGTCTGCACGAAATAAAGCTCCTGGGCAAGGGGACGTCT GCAGCTGATGCCGTGGAGGTCCCAGCCCCCGCTGCGGTTCTCGGAGGTCCGGAGCCCCTGATGCAGTGCA CAGCCTGGCTGAATGCCTATTTCCACCAGCCCGAGGCTATCGAAGAGTTCCCCGTGCCGGCTCTTCACCA TCCCGTTTTCCAGCAAGAGTCGTTCACCAGACAGGTGTTATGGAAGCTGCTGAAGGTTGTGAAATTCGGA GAAGTGATTTCTTACCAGCAATTAGCAGCCCTGGCAGGCAACCCCAAAGCCGCGCGAGCAGTGGGAGGAG CAATGAGAGGCAATCCTGTCCCCATCCTCATCCCGTGCCACAGAGTGGTCTGCAGCAGCGGAGCCGTGGG CAACTACTCCGGAGGACTGGCCGTGAAGGAATGGCTTCTGGCCCATGAAGGCCACCGGTTGGGGAAGCCA GGCTTGGGAGGGAGCTCAGGTCTGGCAGGGGCCTGGCTCAAGGGAGCGGGAGCTACCTCGGGCTCCCCGC CTGCTGGCCGAAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC229131 representing NM_002412
Red=Cloning site Green=Tags(s) MLGQPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTS AADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFG EVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP GLGGSSGLAGAWLKGAGATSGSPPAGRN myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_002412 |
| ORF Size | 714 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Reference Data | |
| RefSeq | NM_002412.4 |
| RefSeq ORF | 624 bp |
| Locus ID | 4255 |
| UniProt ID | P16455 |
| Domains | Methyltransf_1 |
| Protein Families | Druggable Genome |
| MW | 24.9 kDa |
| Gene Summary | Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. [provided by RefSeq, Sep 2015] |
Citations (5)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
miR-221-3p promotes hepatocellular carcinogenesis by downregulating O6-methylguanine-DNA methyltransferase
,Chen, Z;Xiang, B;Qi, L;Zhu, S;Li, L;,
Cancer Biol Ther
,PubMed ID 33023393
[MGMT]
|
|
Targeting BC200/miR218-5p Signaling Axis for Overcoming Temozolomide Resistance and Suppressing Glioma Stemness
,Su, YK;Lin, JW;Shih, JW;Chuang, HY;Fong, IH;Yeh, CT;Lin, CM;,
Cells
,PubMed ID 32784466
[MGMT]
|
|
Cytotoxic synergy between alisertib and carboplatin versus alisertib and irinotecan are inversely dependent on MGMT levels in glioblastoma cells
,Sak, M;Zumbar, CT;King, PD;Li, X;Mifsud, CS;Usubalieva, A;Anderson, CD;Chesnick, HM;McElroy, JP;Chakravarti, A;Burton, EC;Lehman, NL;,
J. Neurooncol.
,PubMed ID 31011934
[MGMT]
|
|
Inhibition of NF-κB results in anti-glioma activity and reduces temozolomide-induced chemoresistance by down-regulating MGMT gene expression
,Yu, Z;Chen, Y;Wang, S;Li, P;Zhou, G;Yuan, Y;,
Cancer Letters
,PubMed ID 29705182
[MGMT]
|
|
MGMT Is a Molecular Determinant for Potency of the DNA-EGFR–Combi-Molecule ZRS1
,Ying Huang, Zakaria Rachid, and Bertrand J. Jean-Claude,
Mol. Cancer Res., Mar 2011; 9: 320 - 331
[MGMT]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC201612 | MGMT (Myc-DDK-tagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) |
CNY 3,600.00 |
|
| RC201612L1 | Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC201612L3 | Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC229131L1 | Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC229131L2 | Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), mGFP tagged |
CNY 5,890.00 |
|
| RC229131L3 | Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC229131L4 | Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), mGFP tagged |
CNY 6,000.00 |
|
| RG201612 | MGMT (tGFP-tagged) - Human O-6-methylguanine-DNA methyltransferase (MGMT) |
CNY 4,370.00 |
|
| RG229131 | MGMT (tGFP-tagged) - Human O-6-methylguanine-DNA methyltransferase (MGMT) |
CNY 5,200.00 |
|
| SC108494 | MGMT (untagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) |
CNY 3,600.00 |
|
| SC322190 | MGMT (untagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) |
CNY 3,600.00 |
|
| SC327766 | MGMT (untagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) |
CNY 3,600.00 |
