UBE2D3 (NM_003340) Human Tagged ORF Clone
CAT#: RC207371
UBE2D3 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1
ORF Plasmid: tGFP
"NM_003340" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | E2(17)KB3; UBC4/5; UBCH5C |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC207371 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGCTGAAACGGATTAATAAGGAACTTAGTGATTTGGCCCGTGACCCTCCAGCACAATGTTCTGCAG GTCCAGTTGGGGATGATATGTTTCATTGGCAAGCCACAATTATGGGACCTAATGACAGCCCATATCAAGG CGGTGTATTCTTTTTGACAATTCATTTTCCTACAGACTACCCCTTCAAACCACCTAAGGTTGCATTTACA ACAAGAATTTATCATCCAAATATTAACAGTAATGGCAGCATTTGTCTCGATATTCTAAGATCACAGTGGT CGCCTGCTTTAACAATTTCTAAAGTTCTTTTATCCATTTGTTCACTGCTATGTGATCCAAACCCAGATGA CCCCCTAGTGCCAGAGATTGCACGGATCTATAAAACAGACAGAGATAAGTACAACAGAATATCTCGGGAA TGGACTCAGAAGTATGCCATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207371 protein sequence
Red=Cloning site Green=Tags(s) MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE WTQKYAM myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003340 |
ORF Size | 441 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003340.6 |
RefSeq Size | 3976 bp |
RefSeq ORF | 444 bp |
Locus ID | 7323 |
UniProt ID | P61077 |
Domains | UBCc |
Protein Pathways | Ubiquitin mediated proteolysis |
MW | 16.7 kDa |
Gene Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. [provided by RefSeq, Jan 2017] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
High-Throughput Screening for Linear Ubiquitin Chain Assembly Complex (LUBAC) Selective Inhibitors Using Homogenous Time-Resolved Fluorescence (HTRF)-Based Assay System
,Katsuya, K;Hori, Y;Oikawa, D;Yamamoto, T;Umetani, K;Urashima, T;Kinoshita, T;Ayukawa, K;Tokunaga, F;Tamaru, M;,
SLAS Discov
,PubMed ID 30071751
[UBE2D3]
|
SLUG-induced Elevation of D1 Cyclin in Breast Cancer Cells through the Inhibition of Its Ubiquitination
,Mukul K. Mittal, Kshipra Singh, Smita Misra, and Gautam Chaudhuri,
J. Biol. Chem., Jan 2011; 286: 469 - 479
[UBE2D3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC207371L1 | Lenti ORF clone of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC207371L2 | Lenti ORF clone of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC207371L3 | Lenti ORF clone of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC207371L4 | Lenti ORF clone of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RG207371 | UBE2D3 (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1 |
CNY 2,800.00 |
|
SC118047 | UBE2D3 (untagged)-Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1 |
CNY 1,200.00 |