RAMP2 (NM_005854) Human Tagged ORF Clone
CAT#: RC206531
RAMP2 (Myc-DDK-tagged)-Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2)
ORF Plasmid: tGFP
"NM_005854" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC206531 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTCGCTCCGGGTGGAGCGCGCCGGCGGCCCGCGTCTCCCTAGGACCCGAGTCGGGCGGCCGGCAG CGCTCCGCCTCCTCCTCCTGCTGGGCGCTGTCCTGAATCCCCACGAGGCCCTGGCTCAGCCTCTTCCCAC CACAGGCACACCAGGGTCAGAAGGGGGGACGGTGAAGAACTATGAGACAGCTGTCCAATTTTGCTGGAAT CATTATAAGGATCAAATGGATCCTATCGAAAAGGATTGGTGCGACTGGGCCATGATTAGCAGGCCTTATA GCACCCTGCGAGATTGCCTGGAGCACTTTGCAGAGTTGTTTGACCTGGGCTTCCCCAATCCCTTGGCAGA GAGGATCATCTTTGAGACTCACCAGATCCACTTTGCCAACTGCTCCCTGGTGCAGCCCACCTTCTCTGAC CCCCCAGAGGATGTACTCCTGGCCATGATCATAGCCCCCATCTGCCTCATCCCCTTCCTCATCACTCTTG TAGTATGGAGGAGTAAAGACAGTGAGGCCCAGGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206531 protein sequence
Red=Cloning site Green=Tags(s) MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWN HYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSD PPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005854 |
ORF Size | 525 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005854.3 |
RefSeq Size | 808 bp |
RefSeq ORF | 528 bp |
Locus ID | 10266 |
UniProt ID | O60895 |
Domains | RAMP |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Vascular smooth muscle contraction |
MW | 19.6 kDa |
Gene Summary | The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC206531L1 | Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC206531L2 | Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2), mGFP tagged |
CNY 5,890.00 |
|
RC206531L3 | Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC206531L4 | Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2), mGFP tagged |
CNY 6,000.00 |
|
RG206531 | RAMP2 (tGFP-tagged) - Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2) |
CNY 5,200.00 |
|
SC310647 | RAMP2 (untagged)-Human receptor (G protein-coupled) activity modifying protein 2 (RAMP2) |
CNY 3,600.00 |