Stathmin 1 (STMN1) (NM_203401) Human Tagged ORF Clone
CAT#: RC205073
STMN1 (Myc-DDK-tagged)-Human stathmin 1 (STMN1), transcript variant 1
ORF Plasmid: tGFP
"NM_203401" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 4 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C1orf215; Lag; LAP18; OP18; PP17; PP19; PR22; SMN |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205073 representing NM_203401
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTTCTTCTGATATCCAGGTGAAAGAACTGGAGAAGCGTGCCTCAGGCCAGGCTTTTGAGCTGATTC TCAGCCCTCGGTCAAAAGAATCTGTTCCAGAATTCCCCCTTTCCCCTCCAAAGAAGAAGGATTTTTCCCT GGAGGAAATTCAGAAGAAATTAGAAGCTGCAGAAGAAAGACGCAAGTCCCATGAAGCTGAGGTCTTGAAG CAGCTGGCTGAGAAACGAGAGCACGAGAAAGAAGTGCTTCAGAAGGCAATAGAAGAGAACAACAACTTCA GTAAAATGGCAGAAGAGAAACTGACCCACAAAATGGAAGCTAATAAAGAGAACCGAGAGGCACAAATGGC TGCCAAACTGGAACGTTTGCGAGAGAAGGATAAGCACATTGAAGAAGTGCGGAAGAACAAAGAATCCAAA GACCCTGCTGACGAGACTGAAGCTGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205073 representing NM_203401
Red=Cloning site Green=Tags(s) MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLK QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK DPADETEAD myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_203401 |
ORF Size | 447 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_203401.1, NP_981946.1 |
RefSeq Size | 1730 bp |
RefSeq ORF | 450 bp |
Locus ID | 3925 |
UniProt ID | P16949 |
Protein Pathways | MAPK signaling pathway |
MW | 17.1 kDa |
Gene Summary | This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009] |
Citations (4)
The use of this cDNA Clones has been cited in the following citations: |
---|
Stathmin 1 promotes the progression of liver cancer through interacting with YAP1
,Liu, YP;Pan, LL;Kong, CC;,
Eur Rev Med Pharmacol Sci
,PubMed ID 32706072
[Stathmin 1]
|
Ferroptosis is governed by differential regulation of transcription in liver cancer
,Zhang, X;Du, L;Qiao, Y;Zhang, X;Zheng, W;Wu, Q;Chen, Y;Zhu, G;Liu, Y;Bian, Z;Guo, S;Yang, Y;Ma, L;Yu, Y;Pan, Q;Sun, F;Wang, J;,
Redox Biol
,PubMed ID 31108460
[Stathmin 1]
|
Overexpression of stathmin plays a pivotal role in the metastasis of esophageal squamous cell carcinoma
,Han, G;Wu, Z;Zhao, N;Zhou, L;Liu, F;Niu, F;Xu, Y;Zhao, X;,
Oncotarget
,PubMed ID 28977901
[Stathmin 1]
|
Identifizierung neuer Coregulatoren von SOX9 und RUNX2 in chondrogenen Progenitorzellen in der Osteoarthrose
,Cingöz, G;,
Thesis
[Stathmin 1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205073L1 | Lenti ORF clone of Human stathmin 1 (STMN1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205073L2 | Lenti ORF clone of Human stathmin 1 (STMN1), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RC205073L3 | Lenti ORF clone of Human stathmin 1 (STMN1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205073L4 | Lenti ORF clone of Human stathmin 1 (STMN1), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RG205073 | STMN1 (tGFP-tagged) - Human stathmin 1 (STMN1), transcript variant 1 |
CNY 2,800.00 |
|
SC308156 | STMN1 (untagged)-Human stathmin 1 (STMN1), transcript variant 1 |
CNY 1,320.00 |
|
SC321093 | STMN1 (untagged)-Human stathmin 1 (STMN1), transcript variant 1 |
CNY 1,200.00 |
其它Stathmin 1产品