Sumo 1 (SUMO1) (NM_003352) Human Tagged ORF Clone
CAT#: RC200633
SUMO1 (Myc-DDK-tagged)-Human SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) (SUMO1), transcript variant 1
ORF Plasmid: tGFP
"NM_003352" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DAP1; GMP1; OFC10; PIC1; SENP2; SMT3; SMT3C; SMT3H3; UBL1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200633 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAAC TCAAAGTCATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACT CAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATGAATTCACTCAGGTTTCTCTTTGAGGGTCAGAGA ATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAAC AAACGGGGGGTCATTCAACAGTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200633 protein sequence
Red=Cloning site Green=Tags(s) MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR IADNHTPKELGMEEEDVIEVYQEQTGGHSTV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003352 |
ORF Size | 303 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003352.8 |
RefSeq Size | 1527 bp |
RefSeq ORF | 306 bp |
Locus ID | 7341 |
UniProt ID | P63165 |
Domains | UBQ |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
MW | 11.6 kDa |
Gene Summary | This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Jul 2008] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Krϋppel‐like factor 15 suppresses renal glomerular mesangial cell proliferation via enhancing P53 SUMO1 conjugation, et al. Krϋppel‐like factor 15 suppresses renal glomerular mesangial cell proliferation via enhancing P53 SUMO1 conjugation
,null,
Journal of Cellular and Molecular Medicine
,PubMed ID 33949114
[Sumo 1]
|
IL-2 regulates tumor-reactive CD8+ T cell exhaustion by activating the aryl hydrocarbon receptor
,Liu, Y;Zhou, N;Zhou, L;Wang, J;Zhou, Y;Zhang, T;Fang, Y;Deng, J;Gao, Y;Liang, X;Lv, J;Wang, Z;Xie, J;Xue, Y;Zhang, H;Ma, J;Tang, K;Fang, Y;Cheng, F;Zhang, C;Dong, B;Zhao, Y;Yuan, P;Gao, Q;Zhang, H;Xiao-Feng Qin, F;Huang, B;,
Nature immunology
,PubMed ID 33432230
[Sumo 1]
|
Hepatitis B Core Protein Is Post-Translationally Modified through K29-Linked Ubiquitination
,null,
Cells
,PubMed ID 33256078
[Sumo 1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200633L1 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) (SUMO1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC200633L2 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) (SUMO1), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC200633L3 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) (SUMO1), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC200633L4 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) (SUMO1), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RG200633 | SUMO1 (tGFP-tagged) - Human SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) (SUMO1), transcript variant 1 |
CNY 2,800.00 |
|
SC321415 | SUMO1 (untagged)-Human SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) (SUMO1), transcript variant 1 |
CNY 1,200.00 |