Ins2 (NM_001185083) Mouse Tagged ORF Clone
CAT#: MR226647
- TrueORF®
Ins2 (Myc-DDK-tagged) - Mouse insulin II (Ins2), transcript variant 1
ORF Plasmid: tGFP
"NM_001185083" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AA986540; In; Ins-2; InsII; Mod; Mody; Mody4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR226647 representing NM_001185083
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCTGTGGATGCGCTTCCTGCCCCTGCTGGCCCTGCTCTTCCTCTGGGAGTCCCACCCCACCCAGG CTTTTGTCAAGCAGCACCTTTGTGGTTCCCACCTGGTGGAGGCTCTCTACCTGGTGTGTGGGGAGCGTGG CTTCTTCTACACACCCATGTCCCGCCGTGAAGTGGAGGACCCACAAGTGGCACAACTGGAGCTGGGTGGA GGCCCGGGAGCAGGTGACCTTCAGACCTTGGCACTGGAGGTGGCCCAGCAGAAGCGTGGCATTGTAGATC AGTGCTGCACCAGCATCTGCTCCCTCTACCAGCTGGAGAACTACTGCAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR226647 representing NM_001185083
Red=Cloning site Green=Tags(s) MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGG GPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001185083 |
ORF Size | 330 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001185083.2, NP_001172012.1 |
RefSeq Size | 455 bp |
RefSeq ORF | 333 bp |
Locus ID | 16334 |
UniProt ID | P01326 |
MW | 12.8 kDa |
Gene Summary | This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. The encoded precursor protein undergoes proteolytic cleavage to produce a disulfide-linked heterodimeric functional protein that is stored in secretory granules. An increase in blood glucose levels, among others, induces the release of insulin from the secretory granules. Mice deficient in the functional hormone encoded by this gene develop diabetes mellitus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Sertoli Cells Engineered to Express Insulin to Lower Blood Glucose in Diabetic Mice
,Kaur, G;Thompson, LA;Babcock, RL;Mueller, K;Dufour, JM;,
DNA Cell Biol.
,PubMed ID 29927618
[INS2]
|
An oral vaccine for type 1 diabetes based on live attenuated Salmonella
,Husseiny, MI;Rawson, J;Kaye, A;Nair, I;Todorov, I;Hensel, M;Kandeel, F;Ferreri, K;,
Vaccine
,PubMed ID 24631074
[INS2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC208792 | Ins2 (untagged) - Mouse insulin II (Ins2), transcript variant 1, (10ug) |
CNY 3,990.00 |
|
MG226647 | Ins2 (tGFP-tagged) - Mouse insulin II (Ins2) transcript variant 1, (10ug) |
CNY 2,800.00 |
|
MR226647L3 | Lenti ORF clone of Ins2 (Myc-DDK-tagged) - Mouse insulin II (Ins2), transcript variant 1 |
CNY 4,750.00 |
|
MR226647L4 | Lenti ORF clone of Ins2 (mGFP-tagged) - Mouse insulin II (Ins2), transcript variant 1 |
CNY 4,750.00 |