Rhoh (NM_001081105) Mouse Tagged ORF Clone

CAT#: MG223809

  • TrueORF®

Rhoh (tGFP-tagged) - Mouse ras homolog gene family member H (Rhoh), (10ug)

ORF Plasmid: DDK tGFP



  "NM_001081105" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms 5830400A04Rik; Arhh; AU019774
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG223809 representing NM_001081105
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGAGCTCAATCAAGTGCGTGCTGGTAGGGGACAGTGCTGTGGGGAAAACCTCACTGTTGGTGCGCT
TCACCTCTGAGACCTTCCCGGAGGCCTACAAACCCACGGTGTACGAGAATACGGGTGTAGACGTCTTCAT
GGATGGCATCCAGATCAGCCTGGGTCTCTGGGACACTGCCGGCAACGACGCCTTCAGAAGTATCCGGCCC
CTGTCCTACCAGCAGGCAGACGTGGTACTGATGTGCTACTCTGTGGCCAACCATAACTCGTTCCTGAACT
TGAAGAACAAATGGATTAGTGAGATCAGGAGCAACCTACCCTGTACCCCGGTGCTGGTTGTGGCCACACA
GACGGACCAGAGAGAGGTGGGACCTCACAGGGCTTCCTGCATCAATGCCATAGAAGGGAAGAGACTTGCC
CAGGATGTGAGAGCCAAGGGCTACCTGGAGTGCTCAGCCCTCAGCAACCGGGGAGTACAGCAGGTATTTG
AATGTGCTGTCCGAACAGCTGTCAACCAGGCCAGGAGGCGAAACAGAAGGAAGCTGTTCTCCATCAATGA
ATGCAAGATCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG223809 representing NM_001081105
Red=Cloning site Green=Tags(s)

MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRP
LSYQQADVVLMCYSVANHNSFLNLKNKWISEIRSNLPCTPVLVVATQTDQREVGPHRASCINAIEGKRLA
QDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRKLFSINECKIF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001081105
ORF Size 573 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001081105.2
RefSeq Size 4960 bp
RefSeq ORF 576 bp
Locus ID 74734
UniProt ID Q9D3G9
Gene Summary Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins. Inhibits the activation of NF-kappa-B by TNF and IKKB and the activation of CRK/p38 by TNF. Inhibits activities of RAC1, RHOA and CDC42. Negatively regulates leukotriene production in neutrophils (By similarity). Negative regulator of hematopoietic progenitor cell proliferation, survival and migration. Critical regulator of thymocyte development and T-cell antigen receptor (TCR) signaling by mediating recruitment and activation of ZAP70. Required for phosphorylation of CD3Z, membrane translocation of ZAP70 and subsequent activation of the ZAP70-mediated pathways. Essential for efficient beta-selection and positive selection by promoting the ZAP70-dependent phosphorylation of the LAT signalosome during pre-TCR and TCR signaling. Crucial for thymocyte maturation during DN3 to DN4 transition and during positive selection. Plays critical roles in mast cell function by facilitating phosphorylation of SYK in Fc epsilon RI-mediated signal transduction. Essential for the phosphorylation of LAT, LCP2, PLCG1 and PLCG2 and for Ca(2+) mobilization in mast cells.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...