LHPP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LHPP antibody: synthetic peptide directed towards the middle region of human LHPP. Synthetic peptide located within the following region: ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	phospholysine phosphohistidine inorganic pyrophosphate phosphatase
Database Link	NP_071409 Entrez Gene 64077 Human UniProt ID Q9H008
Background	The function of this protein remains unknown.
Synonyms	HDHD2B
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Pig: 83%; Guinea pig: 83%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Oxidative phosphorylation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.