SR140 (U2SURP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SR140 antibody: synthetic peptide directed towards the N terminal of human SR140. Synthetic peptide located within the following region: NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	118 kDa
Gene Name	U2 snRNP associated SURP domain containing
Database Link	NP_001073884 Entrez Gene 23350 Human UniProt ID O15042
Background	The specific function of SR140 is not yet known.
Synonyms	fSAPa; SR140
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Yeast: 83%; Goat: 80%
Reference Data
Protein Pathways	Spliceosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.