CCR4 NOT transcription complex subunit 3 (CNOT3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CNOT3 antibody: synthetic peptide directed towards the C terminal region of human CNOT3. Synthetic peptide located within the following region: MMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	82 kDa
Gene Name	CCR4-NOT transcription complex subunit 3
Database Link	NP_055331 Entrez Gene 4849 Human UniProt ID O75175
Background	CNOT3 is a protein component of CCR4-NOT protein complex. Yeast CCR4-NOT is a global regulator of RNA polymerase II transcription. It is comprised of yeast NOT1 to NOT5, yeast CCR4 and additional proteins like yeast CAF1.
Synonyms	LENG2; NOT3; NOT3H
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transcription Factors
Protein Pathways	RNA degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.