SET Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, IP, WB
Recommend Dilution	WB, IHC, IP
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	SET nuclear proto-oncogene
Database Link	NP_003002 Entrez Gene 56086 MouseEntrez Gene 6418 Human UniProt ID Q01105
Background	The protein encoded byThis gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT).This inhibition is most likely accomplished by masking histone lysines from being acetylated, andThe consequence is to silence HAT-dependent transcription.The encoded protein is part of a complex localized toThe endoplasmic reticulum but is found inThe nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes.This protein can also enhance DNA replication ofThe adenovirus genome. Several transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Oct 2011]
Synonyms	2PP2A; I2PP2A; IGAAD; IPP2A2; PHAPII; TAF-I; TAF-IBETA
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Phosphatase, Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.