OCEL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OCEL1 antibody: synthetic peptide directed towards the C terminal of human OCEL1. Synthetic peptide located within the following region: VWREFEMKRMDPGFLDKQARCHYLKGKLRHLKTQIQKFDDQGDSEGSVYF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	occludin/ELL domain containing 1
Database Link	NP_078854 Entrez Gene 79629 Human UniProt ID Q9H607
Background	OCEL1 belongs to the ELL/occludin family. The exact functions of OCEL1 remain unknown.
Synonyms	FWP009; S863-9
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 86%; Guinea pig: 86%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.