OCEL1 Rabbit Polyclonal Antibody
CAT#: TA339756
Rabbit Polyclonal Anti-OCEL1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-OCEL1 antibody: synthetic peptide directed towards the C terminal of human OCEL1. Synthetic peptide located within the following region: VWREFEMKRMDPGFLDKQARCHYLKGKLRHLKTQIQKFDDQGDSEGSVYF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 29 kDa |
Gene Name | occludin/ELL domain containing 1 |
Database Link | |
Background | OCEL1 belongs to the ELL/occludin family. The exact functions of OCEL1 remain unknown. |
Synonyms | FWP009; S863-9 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 86%; Guinea pig: 86%; Dog: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |